Host taxon 9606
Protein NP_001303892.1
probetacellulin isoform 2 precursor
Homo sapiens
Gene BTC, UniProt P35070
>NP_001303892.1|Haemophilus ducreyi 35000HP|probetacellulin isoform 2 precursor
MDRAARCSGASSLPLLLALALGLVILHCVVADGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVPLRKRRKRKKKEEEMETLGKDITPINEDIEETNIA
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●○ -3.68 | -3.6754025271247 | 8.3e-9 | 31213562 | |
Retrieved 1 of 3 entries in 27.2 ms
(Link to these results)