Host taxon 9606
Protein NP_001254635.1
programmed cell death 1 ligand 1 isoform b precursor
Homo sapiens
Gene CD274, UniProt Q9NZQ7
>NP_001254635.1|Haemophilus ducreyi 35000HP|programmed cell death 1 ligand 1 isoform b precursor
MRIFAVFIFMTYWHLLNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTHLVILGAILLCLGVALTFIFRLRKGRMMDVKKCGIQDTNSKKQSDTHLEET
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● 5.33 | 5.33398214131029 | 3.8e-19 | 31213562 | |
Retrieved 1 of 1 entries in 1.6 ms
(Link to these results)