Host taxon 9606
Protein NP_002643.1
prolactin-inducible protein precursor
Homo sapiens
Gene PIP, UniProt P12273
>NP_002643.1|Haemophilus ducreyi 35000HP|prolactin-inducible protein precursor
MRLLQLLFRASPATLLLVLCLQLGANKAQDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQTELKECMVVKTYLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTIEILKVE
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● -4.37 | -4.37262714540635 | 1.4e-8 | 31213562 | |
Retrieved 1 of 1 entries in 1.6 ms
(Link to these results)