Host taxon 9606
Protein NP_001268457.1
proteasome activator complex subunit 1 isoform 3
Homo sapiens
Gene PSME1, UniProt Q06323
>NP_001268457.1|Haemophilus ducreyi 35000HP|proteasome activator complex subunit 1 isoform 3
MAMLRVQPEAQAKVDVFREDLCTKTENLLGSYFPKKISELDAFLKEPALNEANLSNLKAPLDIPVPDPVKEKEKEERKKQQEKEDKDEKKKGEDEDKGPPCGPVNCNEKIVVLLQRLKPEIKDVIEQLNLVTTWLQLQIPRIEDGNNFGVAVQEKVFELMTSLHTKLEGFHTQISKYFSERGDAVTKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIRNAYVRRLCYMTSS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●○ 3.5 | 3.50001250524535 | 0.0004 | 31213562 | |
Retrieved 1 of 1 entries in 37.2 ms
(Link to these results)