Host taxon 9606
Protein NP_001305861.1
protein FAM216B
Homo sapiens
Gene FAM216B, UniProt Q8N7L0
>NP_001305861.1|Haemophilus ducreyi 35000HP|protein FAM216B
MGQNWKRQQKLWNVPQLPFIRVPPSIYDTSLLKALNQGQQRYFYSIMRIYNSRPQWEALQTRYIHSLQHQQLLGYITQREALSYALVLRDSTKRASAKVAPQRTIPRKTSAMTRRCPSVLPVSVVLPRAQSKRRQVLRN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●○ 3.24 | 3.24332915558038 | 2.7e-8 | 31213562 | |
Retrieved 1 of 1 entries in 82.6 ms
(Link to these results)