Host taxon 9606
Protein NP_001291357.1
protein GAPT
Homo sapiens
Gene GAPT, UniProt Q8N292
>NP_001291357.1|Haemophilus ducreyi 35000HP|protein GAPT
MSKSCGNNLAAISVGISLLLLLVVCGIGCVWHWKHRVATRFTLPRFLQRRSSRRKVCTKTFLGPRIIGLRHEISVETQDHKSAVRGNNTHDNYENVEAGPPKAKGKTDKELYENTGQSNFEEHIYGNETSSDYYNFQKPRPSEVPQDEDIYILPDSY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●○○ 2.8 | 2.80480806370188 | 6.5e-13 | 31213562 | |
Retrieved 1 of 1 entries in 109.8 ms
(Link to these results)