Host taxon 9606
Protein NP_005969.2
protein S100-A2 isoform 1
Homo sapiens
Gene S100A2, UniProt P29034
>NP_005969.2|Haemophilus ducreyi 35000HP|protein S100-A2 isoform 1
MMCSSLEQALAVLVTTFHKYSCQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDRP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●○○ 2.94 | 2.93625360502721 | 6.1e-8 | 31213562 | |
Retrieved 1 of 1 entries in 70.7 ms
(Link to these results)