Host taxon 9606
Protein NP_789793.1
protein S100-A7A
Homo sapiens
Gene S100A7A, UniProt Q86SG5
>NP_789793.1|Haemophilus ducreyi 35000HP|protein S100-A7A
MSNTQAERSIIGMIDMFHKYTGRDGKIEKPSLLTMMKENFPNFLSACDKKGIHYLATVFEKKDKNEDKKIDFSEFLSLLGDIAADYHKQSHGAAPCSGGSQ
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● 8.27 | 8.26690595953204 | 9.0e-36 | 31213562 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)