Host taxon 9606
Protein NP_005971.1
protein S100-P
Homo sapiens
Gene S100P, UniProt P25815
>NP_005971.1|Haemophilus ducreyi 35000HP|protein S100-P
MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLK
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● 4.06 | 4.0590695415661 | 3.6e-12 | 31213562 | |
Retrieved 1 of 1 entries in 69.8 ms
(Link to these results)