Host taxon 9606
Protein NP_001034566.1
protein THEMIS2 isoform 2
Homo sapiens
Gene THEMIS2, UniProt Q5TEJ8
>NP_001034566.1|Haemophilus ducreyi 35000HP|protein THEMIS2 isoform 2
MEPVPLQDFVRALDPASLPRVLRVCSGVYFEGSIYEISGNECCLSTGDLIKVTQVRLQKVVCENPKTSQTMELAPNFQVFSSLRIAATRSAAQTQGEDLARVHQGWLQYVQQDSCPQEGPQAR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●○ 3.45 | 3.45235472020127 | 4.3e-15 | 31213562 | |
Retrieved 1 of 1 entries in 23.8 ms
(Link to these results)