Bacterial taxon 233412
Protein WP_010945627.1
PTS transporter subunit EIIA
Haemophilus ducreyi 35000HP
Gene n/a, UniProt Q7U334
>WP_010945627.1|Haemophilus ducreyi 35000HP|PTS transporter subunit EIIA
MLKESLIENNSILLNQHVADWRAAIKLGTDLLEKAGAIEARYYTNIVSKIEEMGPYIILAPGLAMPHARPEEGVIKTSFALVTLAEPVYFDGEDEPVSVLITLAGSDSDQHMEGLMEVTQILDDAESDSGVNLDKVLACKTAEEIYAMIDASLGA
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | pathogen | Skin tissue | 6-8 days | ●●○○○ 1.97 | 1.96775651416989 | 1.4e-11 | 31213562 | Bacterial control measured at mid-exponential growth phase |
Retrieved 1 of 1 entries in 25.8 ms
(Link to these results)