Host taxon 9606
Protein NP_057431.2
putative N-acetyltransferase 8B
Homo sapiens
Gene NAT8B, UniProt Q9UHF3
>NP_057431.2|Haemophilus ducreyi 35000HP|putative N-acetyltransferase 8B
MAPYHIRKYQESDRKSVVGLLSRGMAEHAPATFRRLLKLPRTLILLLGGALALLLVSGSWILALVFSLSLLPALWFLAKKPWTRYVDIALRTDMSDITKSYLSECGSCFWVGESEEKVVGTVGALPVDDPTLREKRLQLFHLSVDNEHRGQGIAKALVRTVLQFARDQGYSEVVLDTSNIQLSAMGLYQSLGFKKTGQSFFHVWARLVDLHTVHFIYHLPSAQAGRL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●○ 3.99 | 3.99415147132961 | 3.8e-7 | 31213562 | |
Retrieved 1 of 1 entries in 69.9 ms
(Link to these results)