Host taxon 9606
Protein NP_001096079.2
putative uncharacterized protein C5orf58
Homo sapiens
Gene C5orf58, UniProt C9J3I9
>NP_001096079.2|Haemophilus ducreyi 35000HP|putative uncharacterized protein C5orf58
MGKKRVTDHKLNVDKVIKNINTISSELKKIKELSQLLLCDLILHFNHPIKTENLAEAERNNPLFEESKISDVSLVSNSFSI
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● 4.36 | 4.36354997067371 | 4.1e-13 | 31213562 | |
Retrieved 1 of 1 entries in 30.9 ms
(Link to these results)