Host taxon 9606
Protein NP_001180303.1
resistin precursor
Homo sapiens
Gene RETN, UniProt Q9HD89
>NP_001180303.1|Haemophilus ducreyi 35000HP|resistin precursor
MKALCLLLLPVLGLLVSSKTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●○ 3.54 | 3.53660713875894 | 0.0023 | 31213562 | |
Retrieved 1 of 1 entries in 23.7 ms
(Link to these results)