Host taxon 9606
Protein NP_061907.2
rho-related GTP-binding protein RhoF precursor
Homo sapiens
Gene RHOF, UniProt Q9HBH0
>NP_061907.2|Haemophilus ducreyi 35000HP|rho-related GTP-binding protein RhoF precursor
MDAPGALAQTAAPGPGRKELKIVIVGDGGCGKTSLLMVYSQGSFPEHYAPSVFEKYTASVTVGSKEVTLNLYDTAGQEDYDRLRPLSYQNTHLVLICYDVMNPTSYDNVLIKWFPEVTHFCRGIPMVLIGCKTDLRKDKEQLRKLRAAQLEPITYMQGLSACEQIRAALYLECSAKFRENVEDVFREAAKVALSALKKAQRQKKRRLCLLL
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●○○ 2.92 | 2.92321979890235 | 1.8e-10 | 31213562 | |
Retrieved 1 of 1 entries in 3 ms
(Link to these results)