Host taxon 9606
Protein NP_001265288.1
rho-related GTP-binding protein RhoH precursor
Homo sapiens
Gene RHOH, UniProt Q15669
>NP_001265288.1|Haemophilus ducreyi 35000HP|rho-related GTP-binding protein RhoH precursor
MLSSIKCVLVGDSAVGKTSLLVRFTSETFPEAYKPTVYENTGVDVFMDGIQISLGLWDTAGNDAFRSIRPLSYQQADVVLMCYSVANHNSFLNLKNKWIGEIRSNLPCTPVLVVATQTDQREMGPHRASCVNAMEGKKLAQDVRAKGYLECSALSNRGVQQVFECAVRTAVNQARRRNRRRLFSINECKIF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● 5.09 | 5.0900560796915 | 2.1e-16 | 31213562 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)