Host taxon 9606
Protein NP_005606.1
ribonuclease K6 precursor
Homo sapiens
Gene RNASE6, UniProt Q93091
>NP_005606.1|Haemophilus ducreyi 35000HP|ribonuclease K6 precursor
MVLCFPLLLLLLVLWGPVCPLHAWPKRLTKAHWFEIQHIQPSPLQCNRAMSGINNYTQHCKHQNTFLHDSFQNVAAVCDLLSIVCKNRRHNCHQSSKPVNMTDCRLTSGKYPQCRYSAAAQYKFFIVACDPPQKSDPPYKLVPVHLDSIL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●○○ 2.9 | 2.89626820726382 | 7.5e-11 | 31213562 | |
Retrieved 1 of 2 entries in 20.8 ms
(Link to these results)