Bacterial taxon 233412
Protein WP_010945312.1
ribosome maturation factor RimP
Haemophilus ducreyi 35000HP
Gene rimP, UniProt Q7VLI0
>WP_010945312.1|Haemophilus ducreyi 35000HP|ribosome maturation factor RimP
MATLEQKLTVLISDTIESMGYELVGVECQHAGRFLTVRLYIDKEGGVTIDDCSDVSRQVSAIFDVEDPISDKYNLEVSSPGLDRPLFTLAHYARFVGREMVIHLRIPMFDRRKWQGKLTKVDGDLISLEIENNGEHQFIFSNIQKANLIPVFDF
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | pathogen | Skin tissue | 6-8 days | ●●○○○ 1.76 | 1.75511339050426 | 6.1e-11 | 31213562 | Bacterial control measured at mid-exponential growth phase |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)