Host taxon 9606
Protein NP_848578.1
SCP2 sterol-binding domain-containing protein 1
Homo sapiens
Gene SCP2D1, UniProt Q9UJQ7
>NP_848578.1|Haemophilus ducreyi 35000HP|SCP2 sterol-binding domain-containing protein 1
MWKRSDHQPKIKAEDGPLVGQFEVLGSVPEPAMPHPLELSEFESFPVFQDIRLHIREVGAQLVKKVNAVFQLDITKNGKTILRWTIDLKNGSGDMYPGPARLPADTVFTIPESVFMELVLGKMNPQKAFLAGKFKVSGKVLLSWKLERVFKDWAKF
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● -5.43 | -5.43109877787623 | 0.046 | 31213562 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)