Host taxon 9606
Protein NP_068739.1
secretin preproprotein
Homo sapiens
Gene SCT, UniProt P09683
>NP_068739.1|Haemophilus ducreyi 35000HP|secretin preproprotein
MAPRPLLLLLLLLGGSAARPAPPRARRHSDGTFTSELSRLREGARLQRLLQGLVGKRSEQDAENSMAWTRLSAGLLCPSGSNMPILQAWMPLDGTWSPWLPPGPMVSEPAGAAAEGTLRPR
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● -6.45 | -6.44771226281314 | 4.6e-5 | 31213562 | |
Retrieved 1 of 1 entries in 31.2 ms
(Link to these results)