Host taxon 9606
Protein NP_001120852.1
serum amyloid A-2 protein isoform b precursor
Homo sapiens
Gene SAA2, UniProt P0DJI9
>NP_001120852.1|Haemophilus ducreyi 35000HP|serum amyloid A-2 protein isoform b precursor
MKLLTGLVFCSLVLSVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGAWAAEVISLFSAEL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● 4.29 | 4.28675483165335 | 2.1e-8 | 31213562 | |
Retrieved 1 of 1 entries in 24.2 ms
(Link to these results)