Host taxon 9606
Protein NP_001264130.1
sialic acid-binding Ig-like lectin 7 isoform 3 precursor
Homo sapiens
Gene SIGLEC7, UniProt Q9Y286
>NP_001264130.1|Haemophilus ducreyi 35000HP|sialic acid-binding Ig-like lectin 7 isoform 3 precursor
MLLLLLLPLLWGRERVEGQKSNRKDYSLTMQSSVTVQEGMCVHVRCSFSYPVDSQTDSDPVHGYWFRAGNDISWKAPVATNNPAWAVQEETRDRFHLLGDPQTKNCTLSIRDARMSDAGRYFFRMEKGNIKWNYKYDQLSVNVTG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●○ 3.51 | 3.5069325829843 | 4.7e-8 | 31213562 | |
Retrieved 1 of 1 entries in 28.9 ms
(Link to these results)