Host taxon 9606
Protein NP_055265.1
signaling threshold-regulating transmembrane adapter 1 precursor
Homo sapiens
Gene SIT1, UniProt Q9Y3P8
>NP_055265.1|Haemophilus ducreyi 35000HP|signaling threshold-regulating transmembrane adapter 1 precursor
MNQADPRLRAVCLWTLTSAAMSRGDNCTDLLALGIPSITQAWGLWVLLGAVTLLFLISLAAHLSQWTRGRSRSHPGQGRSGESVEEVPLYGNLHYLQTGRLSQDPEPDQQDPTLGGPARAAEEVMCYTSLQLRPPQGRIPGPGTPVKYSEVVLDSEPKSQASGPEPELYASVCAQTRRARASFPDQAYANSQPAAS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●○ 3.01 | 3.00931649880501 | 1.4e-6 | 31213562 | |
Retrieved 1 of 1 entries in 94.7 ms
(Link to these results)