Host taxon 9606
Protein NP_005979.1
small proline-rich protein 2A
Homo sapiens
Gene SPRR2A, UniProt P35326
>NP_005979.1|Haemophilus ducreyi 35000HP|small proline-rich protein 2A
MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKYPPVTPSPPCQSKYPPKSK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● 6.99 | 6.98746281368151 | 1.9e-15 | 31213562 | |
Retrieved 1 of 1 entries in 103 ms
(Link to these results)