Host taxon 9606
Protein NP_001019380.2
small proline-rich protein 2E
Homo sapiens
Gene SPRR2E, UniProt P22531
>NP_001019380.2|Haemophilus ducreyi 35000HP|small proline-rich protein 2E
MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKCPPVTPSPPCQPKCPPKSK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●○○ 2.85 | 2.85142379554107 | 4.5e-5 | 31213562 | |
Retrieved 1 of 1 entries in 3.3 ms
(Link to these results)