Host taxon 9606
Protein NP_001138444.1
sorting nexin-20 isoform 3
Homo sapiens
Gene SNX20, UniProt Q7Z614
>NP_001138444.1|Haemophilus ducreyi 35000HP|sorting nexin-20 isoform 3
MASPEHPGSPGCMGPITQCTARTQQEAPATGPDLPHPGPDGHLDTHSGLSSNSSMTTRELQQYWQNQKCRWKHVKLLFEIASARIEERKVSKFVAPAPDATP
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●○ 3.32 | 3.31583615651034 | 2.5e-14 | 31213562 | |
Retrieved 1 of 1 entries in 49 ms
(Link to these results)