Host taxon 9606
Protein NP_001026886.1
SOSS complex subunit B2 isoform 1
Homo sapiens
Gene NABP1, UniProt Q96AH0
>NP_001026886.1|Haemophilus ducreyi 35000HP|SOSS complex subunit B2 isoform 1
MNRVNDPLIFIRDIKPGLKNLNVVFIVLEIGRVTKTKDGHEVRSCKVADKTGSITISVWDEIGGLIQPGDIIRLTRGYASMWKGCLTLYTGRGGELQKIGEFCMVYSEVPNFSEPNPDYRGQQNKGAQSEQKNNSMNSNMGTGTFGPVGNGVHTGPESREHQFSHAGRSNGRGLINPQLQGTASNQTVMTTISNGRDPRRAFKR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●○○ 2.85 | 2.84907444161991 | 5.1e-9 | 31213562 | |
Retrieved 1 of 1 entries in 11.1 ms
(Link to these results)