Bacterial taxon 233412
Protein WP_010944291.1
STAS domain-containing protein
Haemophilus ducreyi 35000HP
Gene n/a, UniProt Q7VP49
>WP_010944291.1|Haemophilus ducreyi 35000HP|STAS domain-containing protein
MMPEKTLQFGIQEQNGSLFVTLLGELTRDTLLPLWKQRASFLSNPHNETIYWDLNHLLRIDSAGFALLIELLNHYQKQSTNYLINVPDVILTLAGLFGLQDWLDSFLTKSKTD
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | pathogen | Skin tissue | 6-8 days | ●●●○○ -2.16 | -2.16490260821092 | 3.5e-22 | 31213562 | Bacterial control measured at mid-exponential growth phase |
Retrieved 1 of 1 entries in 3.9 ms
(Link to these results)