Host taxon 9606
Protein NP_000627.2
superoxide dismutase [Mn], mitochondrial isoform A precursor
Homo sapiens
Gene SOD2, UniProt P04179
>NP_000627.2|Haemophilus ducreyi 35000HP|superoxide dismutase [Mn], mitochondrial isoform A precursor
MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● 4.26 | 4.26459795902833 | 1.1e-23 | 31213562 | |
Retrieved 1 of 2 entries in 33.1 ms
(Link to these results)