Host taxon 9606
Protein NP_001116697.1
synaptonemal complex central element protein 3
Homo sapiens
Gene SYCE3, UniProt A1L190
>NP_001116697.1|Haemophilus ducreyi 35000HP|synaptonemal complex central element protein 3
MDDADPEERNYDNMLKMLSDLNKDLEKLLEEMEKISVQATWMAYDMVVMRTNPTLAESMRRLEDAFVNCKEEMEKNWQELLHETKQRL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●○ 3.74 | 3.7363026926254 | 0.0039 | 31213562 | |
Retrieved 1 of 1 entries in 39.4 ms
(Link to these results)