Host taxon 9606
Protein NP_001092195.1
T-cell leukemia/lymphoma protein 1A
Homo sapiens
Gene TCL1A, UniProt P56279
>NP_001092195.1|Haemophilus ducreyi 35000HP|T-cell leukemia/lymphoma protein 1A
MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGRPMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● 4.2 | 4.19700525679978 | 0.0052 | 31213562 | |
Retrieved 1 of 2 entries in 11.8 ms
(Link to these results)