Host taxon 9606
Protein NP_000723.1
T-cell surface glycoprotein CD3 delta chain isoform A precursor
Homo sapiens
Gene CD3D, UniProt P04234
>NP_000723.1|Haemophilus ducreyi 35000HP|T-cell surface glycoprotein CD3 delta chain isoform A precursor
MEHSTFLSGLVLATLLSQVSPFKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVAGIIVTDVIATLLLALGVFCFAGHETGRLSGAADTQALLRNDQVYQPLRDRDDAQYSHLGGNWARNK
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●○ 3.95 | 3.94506851464028 | 1.2e-10 | 31213562 | |
Retrieved 1 of 2 entries in 34.5 ms
(Link to these results)