Host taxon 9606
Protein NP_000724.1
T-cell surface glycoprotein CD3 epsilon chain precursor
Homo sapiens
Gene CD3E, UniProt P07766
>NP_000724.1|Haemophilus ducreyi 35000HP|T-cell surface glycoprotein CD3 epsilon chain precursor
MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●○ 3.26 | 3.26283753724218 | 2.0e-9 | 31213562 | |
Retrieved 1 of 1 entries in 40.5 ms
(Link to these results)