Host taxon 9606
Protein NP_000725.1
T-cell surface glycoprotein CD3 zeta chain isoform 2 precursor
Homo sapiens
Gene CD247, UniProt P20963
>NP_000725.1|Haemophilus ducreyi 35000HP|T-cell surface glycoprotein CD3 zeta chain isoform 2 precursor
MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●○ 3.4 | 3.39617651543212 | 1.9e-9 | 31213562 | |
Retrieved 1 of 1 entries in 30.7 ms
(Link to these results)