Host taxon 9606
Protein NP_001139345.1
T-cell surface glycoprotein CD8 alpha chain isoform 1 precursor
Homo sapiens
Gene CD8A, UniProt P01732
>NP_001139345.1|Haemophilus ducreyi 35000HP|T-cell surface glycoprotein CD8 alpha chain isoform 1 precursor
MALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGDKPSLSARYV
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●○ 3.36 | 3.36350164861644 | 1.8e-11 | 31213562 | |
Retrieved 1 of 2 entries in 26.8 ms
(Link to these results)