Host taxon 9606
Protein NP_001171571.1
T-cell surface glycoprotein CD8 beta chain isoform 6 precursor
Homo sapiens
Gene CD8B, UniProt P10966
>NP_001171571.1|Haemophilus ducreyi 35000HP|T-cell surface glycoprotein CD8 beta chain isoform 6 precursor
MRPRLWLLLAAQLTVLHGNSVLQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCRLPRPETQKGLKGKVYQEPLSPNACMDTTAILQPHRSCLTHGS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●○○ 2.98 | 2.97673674924534 | 3.6e-12 | 31213562 | |
Retrieved 1 of 1 entries in 35.2 ms
(Link to these results)