Host taxon 9606
Protein NP_001003806.1
TCR gamma alternate reading frame protein isoform 2
Homo sapiens
Gene TARP, UniProt Q0VGM3
>NP_001003806.1|Haemophilus ducreyi 35000HP|TCR gamma alternate reading frame protein isoform 2
MKTNDTYMKFSWLTVPEKSLDKEHRCIVRHENNKNGVDQEIIFPPIKTDVITMDPKDNCSKDANDTLLLQLTNTSAYYMYLLLLLKSVVYFAIITCCLLRRTAFCCNGEKS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●○ 3.76 | 3.75546014953022 | 4.5e-8 | 31213562 | |
Retrieved 1 of 1 entries in 32.3 ms
(Link to these results)