Host taxon 9606
Protein NP_066926.1
thymosin beta-10
Homo sapiens
Gene TMSB10, UniProt P63313
>NP_066926.1|Haemophilus ducreyi 35000HP|thymosin beta-10
MADKPDMGEIASFDKAKLKKTETQEKNTLPTKETIEQEKRSEIS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●○ 3.23 | 3.22535184352735 | 4.1e-15 | 31213562 | |
Retrieved 1 of 1 entries in 15.2 ms
(Link to these results)