Host taxon 9606
Protein NP_003798.2
tumor necrosis factor ligand superfamily member 14 isoform 1
Homo sapiens
Gene TNFSF14, UniProt O43557
>NP_003798.2|Haemophilus ducreyi 35000HP|tumor necrosis factor ligand superfamily member 14 isoform 1
MEESVVRPSVFVVDGQTDIPFTRLGRSHRRQSCSVARVGLGLLLLLMGAGLAVQGWFLLQLHWRLGEMVTRLPDGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●○○ 2.82 | 2.81936510249239 | 2.2e-7 | 31213562 | |
Retrieved 1 of 1 entries in 16 ms
(Link to these results)