Host taxon 9606
Protein NP_001166985.1
TYRO protein tyrosine kinase-binding protein isoform 3 precursor
Homo sapiens
Gene TYROBP, UniProt O43914
>NP_001166985.1|Haemophilus ducreyi 35000HP|TYRO protein tyrosine kinase-binding protein isoform 3 precursor
MGGLEPCSRLLLLPLLLAVSDCSCSTVSPGVLAGIVMGDLVLTVLIALAVYFLGRLVPRGRGAAEAATRKQRITETESPYQELQGQRSDVYSDLNTQRPYYK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●○ 3.77 | 3.77443974477418 | 5.9e-13 | 31213562 | |
Retrieved 1 of 2 entries in 25.8 ms
(Link to these results)