Host taxon 9606
Protein NP_004214.1
ubiquitin/ISG15-conjugating enzyme E2 L6 isoform 1
Homo sapiens
Gene UBE2L6, UniProt O14933
>NP_004214.1|Haemophilus ducreyi 35000HP|ubiquitin/ISG15-conjugating enzyme E2 L6 isoform 1
MMASMRVVKELEDLQKKPPPYLRNLSSDDANVLVWHALLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKFTTKIYHPNVDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVDRPS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●○ 3.06 | 3.05639194147344 | 1.6e-13 | 31213562 | |
Retrieved 1 of 1 entries in 28.6 ms
(Link to these results)