Host taxon 9606
Protein NP_689503.3
uncharacterized protein C1orf158 isoform 1
Homo sapiens
Gene C1orf158, UniProt Q8N1D5
>NP_689503.3|Haemophilus ducreyi 35000HP|uncharacterized protein C1orf158 isoform 1
MFLTAVNPQPLSTPSWQIETKYSTKVLTGNWMEERRKFTRDTDKTPQSIYRKEYIPFPDHRPDQISRWYGKRKVEGLPYKHLITHHQEPPHRYLISTYDDHYNRHGYNPGLPPLRTWNGQKLLWLPEKSDFPLLAPPTNYGLYEQLKQRQLTPKAGLKQSTYTSSYPRPPLCAMSWREHAVPVPPHRLHPLPHF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● -6.09 | -6.09081008748151 | 0.0096 | 31213562 | |
Retrieved 1 of 2 entries in 15.5 ms
(Link to these results)