Host taxon 9606
Protein NP_006625.1
vesicle-associated membrane protein 5
Homo sapiens
Gene VAMP5, UniProt O95183
>NP_006625.1|Haemophilus ducreyi 35000HP|vesicle-associated membrane protein 5
MAGIELERCQQQANEVTEIMRNNFGKVLERGVKLAELQQRSDQLLDMSSTFNKTTQNLAQKKCWENIRYRICVGLVVVGVLLIILIVLLVVFLPQSSDSSSAPRTQDAGIASGPGN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●○ 3.29 | 3.28625171642622 | 5.1e-9 | 31213562 | |
Retrieved 1 of 2 entries in 19.1 ms
(Link to these results)