Host taxon 9606
Protein NP_001138411.1
vitelline membrane outer layer protein 1 homolog isoform 2 precursor
Homo sapiens
Gene VMO1, UniProt Q7Z5L0
>NP_001138411.1|Haemophilus ducreyi 35000HP|vitelline membrane outer layer protein 1 homolog isoform 2 precursor
MERGAGAKLLPLLLLLRATGFTCAQTDGRNGYTAVIEVTSGGPWGDWAWPEMCPDGFFASGFSLKVEPPQGIPGDDTALNGIRLHCARGNVLGNTHVVESQSGRWGAGVEDPLG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●○ 3.32 | 3.32042045370811 | 1.7e-12 | 31213562 | |
Retrieved 1 of 1 entries in 86.7 ms
(Link to these results)