Host taxon 9606
Protein NP_543017.1
WAP four-disulfide core domain protein 6 precursor
Homo sapiens
Gene WFDC6, UniProt Q9BQY6
>NP_543017.1|Haemophilus ducreyi 35000HP|WAP four-disulfide core domain protein 6 precursor
MGLSGLLPILVPFILLGDIQEPGHAEGILGKPCPKIKVECEVEEIDQCTKPRDCPENMKCCPFSRGKKCLDFRKVSLTLYHKEELE
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●○ -3.26 | -3.25620894509027 | 0.043 | 31213562 | |
Retrieved 1 of 1 entries in 98.5 ms
(Link to these results)