Host taxon 9606
Protein NP_001027903.1
2'-5'-oligoadenylate synthase 2 isoform 3
Homo sapiens
Gene OAS2, UniProt P29728
>NP_001027903.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|2'-5'-oligoadenylate synthase 2 isoform 3
MGNGESQLSSVPAQKLGWFIQEYLKPYEECQTLIDEMVNTICDVLQEPEQFPLVQGVAIGGSYGRKTVLRGNSDGTLVLFFSDLKQFQDQKRSQRDILDKTGDKLKFCLFTKWLKNNFEIQKSLDGFTIQVFTKNQRISFEVLAAFNALSKHCWVSGEKSQRSGCQTALCNL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●●●● 4.25 | 4.25402527272248 | 0.00054 | 25649146 | |
Retrieved 1 of 2 entries in 23 ms
(Link to these results)