Host taxon 9606
Protein NP_001153483.1
alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3 isoform 2
Homo sapiens
Gene ST6GALNAC3, UniProt Q8NDV1
>NP_001153483.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3 isoform 2
MACILKRKSVIAVSFIAAFLFLLVVRLVNEVNFPLLLNCFGQPGTKWIPFSYTYRRPLRTHYGYINVKTQEPLQLDCDLCAIVSNSGQMVGQKVGNEIDRSSCIWRMNNAPTKGYEEDVGRMTMIRVVSHTSVPLLLKNPDYFFKEANTTIYVIWGPFRNMRKDGNGIVYNMLKKTVGIYPNAQIYVTTEKRMSYCDGVFKKETGKDSTE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●●●○ -3.91 | -3.91167594774326 | 0.0074 | 25649146 | |
Retrieved 1 of 1 entries in 31.7 ms
(Link to these results)