Host taxon 9606
Protein NP_001287736.1
basic leucine zipper transcriptional factor ATF-like 2 isoform 2
Homo sapiens
Gene BATF2, UniProt Q8N1L9
>NP_001287736.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|basic leucine zipper transcriptional factor ATF-like 2 isoform 2
MAPVGKRIGGLGDTRVGGPCISQQHESLEKDNLALRKEIQSLQAELAWWSRTLHVHERLCPMDCASCSAPGLLGCWDQAEGLLGPGPQGQHGCREQLELFQTPGSCYPAQPLSPGPQPHDSPSLLQCPLPSLSLGPAVVAEPPVQLSPSPLLFASHTGSSLQGSSSKLSALQPSLTAQTAPPQPLELEHPTRGKLGSSPDNPSSALGLARLQSREHKPALSAATWQGLVVDPSPHPLLAFPLLSSAQVHF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●●●○ 3.07 | 3.06566522350802 | 0.0021 | 25649146 | |
Retrieved 1 of 2 entries in 32 ms
(Link to these results)