Host taxon 9606
Protein NP_001001437.2
C-C motif chemokine 3-like 1 precursor
Homo sapiens
Gene n/a, UniProt P16619
>NP_001001437.2|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|C-C motif chemokine 3-like 1 precursor
MQVSTAALAVLLCTMALCNQVLSAPLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●●●○ 3.49 | 3.48878976248008 | 0.0024 | 25649146 | |
Retrieved 1 of 1 entries in 2.6 ms
(Link to these results)