Host taxon 9606
Protein NP_001556.2
C-X-C motif chemokine 10 precursor
Homo sapiens
Gene CXCL10, UniProt P02778
>NP_001556.2|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|C-X-C motif chemokine 10 precursor
MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●●●● 8.95 | 8.94668162712863 | 4.3e-5 | 25649146 | |
Retrieved 1 of 1 entries in 38.2 ms
(Link to these results)